PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo23G0020300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family Dof
Protein Properties Length: 330aa    MW: 34440.3 Da    PI: 9.4251
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo23G0020300genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.95.4e-3967126362
           zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                      e  lkcprC+stntkfCy+nnyslsqPr+fCkaCrryWt+GGalrnvPvGgg+r+nk+s+
  Spipo23G0020300  67 EPGLKCPRCESTNTKFCYFNNYSLSQPRHFCKACRRYWTRGGALRNVPVGGGCRRNKRSK 126
                      56789****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-3050115IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.64670124IPR003851Zinc finger, Dof-type
PfamPF027011.1E-3270124IPR003851Zinc finger, Dof-type
PROSITE patternPS01361072108IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MVFPSVPVYV DPPNWSQQPI RHQAIGSTSD GGGGHRLPPA AASRPEGSVR AGSMTDRARQ  60
AKLPLPEPGL KCPRCESTNT KFCYFNNYSL SQPRHFCKAC RRYWTRGGAL RNVPVGGGCR  120
RNKRSKGGGG SKSSTSSTDR HSNASAPSTI SATSGTSAIP SNLPPQPTIP FFTSLHTMPA  180
YTGLANMGSS FGGIQPVDAV NFQAGVSSSA GILDQWRLQQ VHQFPFMGGL ETPPPPLSMG  240
LFPLDGQGAV GDGPGYYSGQ TQDNSSAAVP SAHPAPGKGE EEAGELTLRR HYLGISKSDQ  300
FWGDGGATGS GSVWTDISGF SSASTGNIL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00295DAPTransfer from AT2G37590Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1044331e-67AC104433.8 Oryza sativa chromosome 3 BAC OJ1754_E06 genomic sequence, complete sequence.
GenBankAP0149591e-67AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankCP0126111e-67CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008802760.12e-94PREDICTED: dof zinc finger protein DOF5.1-like
TrEMBLA5BZE72e-82A5BZE7_VITVI; Putative uncharacterized protein
STRINGGSMUA_Achr8P02150_0012e-81(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP48932961
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.23e-50OBF-binding protein 3